WNT5A antibody - middle region
Katalog-Nummer ARP32128_P050
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
| Datasheets/Manuals | Printable datasheet for anti-WNT5A (ARP32128_P050) antibody |
|---|
| Tested Species Reactivity | Human | ||
|---|---|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish | ||
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | ||
| Clonality | Polyclonal | ||
| Host | Rabbit | ||
| Application | WB, IHC | ||
| Additional Information | IHC Information: Human Brain, Cortex: Formalin-Fixed, Paraffin-Embedded (FFPE) IHC Information: Human Colon, Myenteric Plexus: Formalin-Fixed, Paraffin-Embedded (FFPE) IHC Information: Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE) | ||
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. | ||
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human WNT5A | ||
| Purification | Affinity Purified | ||
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 87%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 80% | ||
| Peptide Sequence | Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT | ||
| Concentration | 0.5 mg/ml | ||
| Blocking Peptide | For anti-WNT5A (ARP32128_P050) antibody is Catalog # AAP32128 (Previous Catalog # AAPP23848) | ||
| Sample Type Confirmation | WNT5A is strongly supported by BioGPS gene expression data to be expressed in HeLa | ||
| Enhanced Validation |
|
| Reference | Witze,E.S., (2008) Science 320 (5874), 365-369 |
|---|---|
| Gene Symbol | WNT5A |
| Gene Full Name | Wingless-type MMTV integration site family, member 5A |
| Alias Symbols | hWNT5A |
| NCBI Gene Id | 7474 |
| Protein Name | Protein Wnt-5a |
| Description of Target | The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT5A is a member of the WNT protein family. It shows 98%, 98% and 87% amino acid identity to the mouse, rat and the xenopus Wnt5A protein, respectively. The experiments performed in Xenopus laevis embryos identified that human frizzled-5 (hFz5) is the receptor for the Wnt5A ligand and the Wnt5A/hFz5 signaling mediates axis induction.The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 98%, 98% and 87% amino acid identity to the mouse, rat and the xenopus Wnt5A protein, respectively. The experiments performed in Xenopus laevis embryos identified that human frizzled-5 (hFz5) is the receptor for the Wnt5A ligand and the Wnt5A/hFz5 signaling mediates axis induction. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Uniprot ID | P41221 |
| Protein Accession # | NP_003383 |
| Nucleotide Accession # | NM_003392 |
| Protein Size (# AA) | 380 |
| Molecular Weight | 42 kDa |
| Protein Interactions | UBC; LRP6; FZD2; FZD1; ROR2; FZD5; |
-
What is the species homology for "WNT5A Antibody - middle region (ARP32128_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".
-
How long will it take to receive "WNT5A Antibody - middle region (ARP32128_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "WNT5A Antibody - middle region (ARP32128_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "WNT5A Antibody - middle region (ARP32128_P050)"?
This target may also be called "hWNT5A" in publications.
-
What is the shipping cost for "WNT5A Antibody - middle region (ARP32128_P050)"?
The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.
-
What is the guarantee for "WNT5A Antibody - middle region (ARP32128_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "WNT5A Antibody - middle region (ARP32128_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "42 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "WNT5A Antibody - middle region (ARP32128_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "WNT5A"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "WNT5A"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "WNT5A"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "WNT5A"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "WNT5A"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "WNT5A"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.