TNNI3 Antibody - middle region : Biotin
Katalog-Nummer ARP41391_P050-Biotin
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
| Datasheets/Manuals | Printable datasheet for anti-TNNI3 (ARP41391_P050) antibody |
|---|
| Publications | Measurement of Myofilament-Localized Calcium Dynamics in Adult Cardiomyocytes and the Effect of Hypertrophic Cardiomyopathy Mutations. Circ Res. 124, 1228-1239 (2019). 30732532 |
|---|---|
| Tested Species Reactivity | Human, Mouse |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Additional Information | IHC Information: Paraffin embedded heart tissue, tested with an antibody dilution of 5 ug/ml. |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TNNI3 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: RVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNI |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-TNNI3 (ARP41391_P050) antibody is Catalog # AAP41391 (Previous Catalog # AAPP24129) |
| Reference | Bos,J.M., (2008) Am. Heart J. 155 (6), 1128-1134 |
|---|---|
| Gene Symbol | TNNI3 |
| Gene Full Name | Troponin I type 3 (cardiac) |
| Alias Symbols | CMH7, RCM1, cTnI, CMD2A, TNNC1, CMD1FF |
| NCBI Gene Id | 7137 |
| Protein Name | Serine/threonine-protein kinase TNNI3K |
| Description of Target | Troponin I (TnI), along with troponin T (TnT) and troponin C (TnC), is one of 3 subunits that form the troponin complex of the thin filaments of striated muscle. TnI is the inhibitory subunit; blocking actin-myosin interactions and thereby mediating striated muscle relaxation. The TnI subfamily contains three genes: TnI-skeletal-fast-twitch, TnI-skeletal-slow-twitch, and TnI-cardiac. TNNI3 is the TnI-cardiac protein and is exclusively expressed in cardiac muscle tissues.Troponin I (TnI), along with troponin T (TnT) and troponin C (TnC), is one of 3 subunits that form the troponin complex of the thin filaments of striated muscle. TnI is the inhibitory subunit; blocking actin-myosin interactions and thereby mediating striated muscle relaxation. The TnI subfamily contains three genes: TnI-skeletal-fast-twitch, TnI-skeletal-slow-twitch, and TnI-cardiac. This gene encodes the TnI-cardiac protein and is exclusively expressed in cardiac muscle tissues. Mutations in this gene cause familial hypertrophic cardiomyopathy type 7 (CMH7) and familial restrictive cardiomyopathy (RCM). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Uniprot ID | Q59H18 |
| Protein Accession # | NP_000354 |
| Nucleotide Accession # | NM_000363 |
| Protein Size (# AA) | 210 |
| Molecular Weight | 23kDa |
| Protein Interactions | TNNC2; TRIM63; TRIM55; RCAN3; TNNC1; TNNI3K; PKD2L1; TNNI3; TNNT2; TNNT1; PRKCA; PAPPA; PKD2; ACTA1; LYST; |
-
What is the species homology for "TNNI3 Antibody - middle region (ARP41391_P050)"?
The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish".
-
How long will it take to receive "TNNI3 Antibody - middle region (ARP41391_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "TNNI3 Antibody - middle region (ARP41391_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "TNNI3 Antibody - middle region (ARP41391_P050)"?
This target may also be called "CMH7, RCM1, cTnI, CMD2A, TNNC1, CMD1FF" in publications.
-
What is the shipping cost for "TNNI3 Antibody - middle region (ARP41391_P050)"?
The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.
-
What is the guarantee for "TNNI3 Antibody - middle region (ARP41391_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "TNNI3 Antibody - middle region (ARP41391_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "23kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "TNNI3 Antibody - middle region (ARP41391_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "TNNI3"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "TNNI3"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "TNNI3"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "TNNI3"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "TNNI3"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "TNNI3"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.