Sulfotransferase 4A1 (ST4A1, SULT4A1, Brain Sulfotransferase-like Protein, BRSTL1, BR-STL-1, hBR-STL, hBR-STL-1, Nervous System Sulfotransferase, NST, SULTX3, DJ388M5.3)
Katalog-Nummer 134087-100ug
Size : 100ug
Marke : US Biological
134087 Rabbit Anti-Sulfotransferase 4A1 (ST4A1, SULT4A1, Brain Sulfotransferase-like Protein, BRSTL1, BR-STL-1, hBR-STL, hBR-STL-1, Nervous System Sulfotransferase, NST, SULTX3, DJ388M5.3)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgG2a,kGrade
Affinity PurifiedApplications
E WBCrossreactivity
HuAccession #
NM_014351Shipping Temp
Blue IceStorage Temp
-20°CApplications:|Suitable for use in ELISA and Western Blot. Other applications not tested.||Recommended Dilution:|ELISA: 1ng/ml|Optimal dilutions to be determined by the researcher.||AA Sequence:|MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIK*||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Applications
Product Type: Mab|Isotype: IgG2a,k|Clone No: 3C1|Host: mouse|Source: human|Concentration: As Reported |Form: Supplied as a liquid in PBS, pH 7.2.|Purity: Purified by Protein A affinity chromatography.|Immunogen: Partial recombinant corresponding to aa1-101 from human SULT4A1 (NP_055166) with GST tag. MW of the GST tag alone is 26kD.|Specificity: Recognizes human SULT4A1.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Immunogen
Partial recombinant corresponding to aa1-101 from human SULT4A1 (NP_055166) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human SULT4A1.