Sulfotransferase 4A1 (ST4A1, SULT4A1, Brain Sulfotransferase-like Protein, BRSTL1, BR-STL-1, hBR-STL, hBR-STL-1, Nervous System Sulfotransferase, NST, SULTX3, DJ388M5.3)

Applications:|Suitable for use in ELISA and Western Blot. Other applications not tested.||Recommended Dilution:|ELISA: 1ng/ml|Optimal dilutions to be determined by the researcher.||AA Sequence:|MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIK*||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.