Sst antibody - N-terminal region
Katalog-Nummer ARP41905_P050
Size : 100ul
Marke : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-Sst (ARP41905_P050) antibody |
---|
Tested Species Reactivity | Rat |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100% |
Peptide Sequence | Synthetic peptide located within the following region: LQKSLAAATGKQELAKYFLAELLSEPNQTENDALEPEDLPQAAEQDEMRL |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-Sst (ARP41905_P050) antibody is Catalog # AAP41905 |
Gene Symbol | Sst |
---|---|
Gene Full Name | Somatostatin |
Alias Symbols | S, SS, Sm, SOM, SRIF, Smst |
NCBI Gene Id | 20604 |
Protein Name | Somatostatin |
Description of Target | Somatostatin inhibits the release of somatotropin. |
Uniprot ID | P60041 |
Protein Accession # | NP_033241 |
Nucleotide Accession # | NM_009215 |
Protein Size (# AA) | 116 |
Molecular Weight | 13kDa |