Gonadotropin Releasing Hormone (GnRH) Recombinant, Mouse
Katalog-Nummer 154884-50ug
Size : 50ug
Marke : US Biological
154884 Gonadotropin Releasing Hormone (GnRH) Recombinant, Mouse
Clone Type
PolyclonalSwiss Prot
P12025Grade
Highly PurifiedShipping Temp
Blue IceStorage Temp
4°C/-70°CSource:|Recombinant Mouse from E. coli||Accession No:|P12025||Fragment:|Ala22~Asp140 (Accession No: P12025)||Sequence:|MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-AKKKEKVKK GSECSEWTWG PCTPSSKDCG MGFREGTCGA QTQRVHCKVP CNWKKEFGAD CKYKFESWGA CDGSTGTKAR QGTLKKARYN AQCQETIRVT KPCTSKTKSK TKAKKGKGKD||Epitope Tag:|N-terminal Tags: His-tag and S-tag||Molecular Weight:|18.9kD||Applications:|Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE.|Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||Storage and Stability:|Lyophilized and reconstituted products are stable for 6 months after receipt at -70°C. Reconstitute with sterile 20mM Tris, 150mM sodium chloride, pH 8.0.. Aliquot to avoid repeated freezing and thawing. Store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.||Note:|Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.