AAP1 Recombinant Protein
Katalog-Nummer OPCA02041-100UG
Size : 100ug
Marke : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for AAP1 Recombinant Protein (Baker's yeast) (OPCA02041) (OPCA02041) |
---|
Predicted Species Reactivity | Saccharomyces cerevisiae |
---|---|
Product Format | Liquid or Lyophilized powder |
Host | Yeast |
Additional Information | Relevance: Positive effector of glycogen accumulation. May be involved in nutrient-sensing. |
Reconstitution and Storage | -20°C or -80°C |
Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | MSREVLPNNVTPLHYDITLEPNFRAFTFEGSLKIDLQINDHSINSVQINYLEIDFHSARIEGVNAIEVNKNENQQKATLVFPNGTFENLGPSAKLEIIFSGILNDQMAGFYRAKYTDKVTGETKYMATTQMEATDARRAFPCFDEPNLKATFAVTLVSESFLTHLSNMDVRNETIKEGKKYTTFNTTPKMSTYLVAFIVADLRYVESNNFRIPVRVYSTPGDEKFGQFAANLAARTLRFFEDTFNIEYPLPKMDMVAVHEFSAGAMENWGLVTYRVIDLLLDIENSSLDRIQRVAEVIQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSCNKFQPEWKVWEQYVTDNLQRALNLDSLRSSHPIEVPVNNADEINQIFDAISYSKG |
Protein Sequence | MSREVLPNNVTPLHYDITLEPNFRAFTFEGSLKIDLQINDHSINSVQINYLEIDFHSARIEGVNAIEVNKNENQQKATLVFPNGTFENLGPSAKLEIIFSGILNDQMAGFYRAKYTDKVTGETKYMATTQMEATDARRAFPCFDEPNLKATFAVTLVSESFLTHLSNMDVRNETIKEGKKYTTFNTTPKMSTYLVAFIVADLRYVESNNFRIPVRVYSTPGDEKFGQFAANLAARTLRFFEDTFNIEYPLPKMDMVAVHEFSAGAMENWGLVTYRVIDLLLDIENSSLDRIQRVAEVIQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSCNKFQPEWKVWEQYVTDNLQRALNLDSLRSSHPIEVPVNNADEINQIFDAISYSKG |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | E.coli |
Protein Range | 1-389 aa |
Tag | N-terminal 6xHis-SUMO-tagged |
Reference | Global analysis of protein expression in yeast.Ghaemmaghami S., Huh W.-K., Bower K., Howson R.W., Belle A., Dephoure N., O'Shea E.K., Weissman J.S.Nature 425:737-741(2003) |
---|---|
Gene Symbol | AAP1 |
Gene Full Name | arginine/alanine aminopeptidase |
Alias Symbols | AAP1';arginine/alanine aminopeptidase;YHR047C. |
NCBI Gene Id | 856443 |
Protein Name | Alanine/arginine aminopeptidase |
Description of Target | Positive effector of glycogen accumulation. May be involved in nutrient-sensing. |
Uniprot ID | P37898 |
Protein Accession # | NP_011913.1 |
Nucleotide Accession # | NM_001179177.1 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 60.8 kDa |