Sulfotransferase 4A1 (ST4A1, SULT4A1, Brain Sulfotransferase-like Protein, BRSTL1, BR-STL-1, hBR-STL, hBR-STL-1, Nervous System Sulfotransferase, NST, SULTX3, DJ388M5.3) (FITC)

Applications:|Suitable for use in ELISA and Western Blot. Other applications not tested.||Recommended Dilution:|ELISA: 1ng/ml|Optimal dilutions to be determined by the researcher.||AA Sequence:|MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIK*||Storage and Stability:|Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.||Note: Applications are based on unconjugated antibody.