ST3GAL5 Antibody - N-terminal region : Biotin

Cat# ARP46385_T100-Biotin

Size : 100ul

Brand : Aviva Systems Biology

Request more information

Contact local distributor :


Phone : +1 850 650 7790
Datasheets/ManualsPrintable datasheet for anti-ST3GAL5 (ARP46385_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Lane A: Marker. Lane B: Jurkat cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ST3GAL5
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Goat: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%
Peptide SequenceSynthetic peptide located within the following region: DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS
Concentration1.0 mg/ml
Blocking PeptideFor anti-ST3GAL5 (ARP46385_T100) antibody is Catalog # AAP46385 (Previous Catalog # AAPP27169)
ReferenceChung,T.W., (2005) Glycobiology 15 (3), 233-244
Gene SymbolST3GAL5
Gene Full NameST3 beta-galactoside alpha-2,3-sialyltransferase 5
Alias SymbolsSATI, SIAT9, SPDRS, ST3GalV, SIATGM3S, ST3Gal V
NCBI Gene Id8869
Protein NameLactosylceramide alpha-2,3-sialyltransferase
Description of TargetGanglioside GM3 is known to participate in the induction of cell differentiation, modulation of cell proliferation, maintenance of fibroblast morphology, signal transduction, and integrin-mediated cell adhesion. ST3GAL5 is a type II membrane protein which catalyzes the formation of GM3 using lactosylceramide as the substrate. It is a member of glycosyltransferase family 29 and may be localized to the Golgi apparatus. Mutation in its gene has been associated with Amish infantile epilepsy syndrome.Ganglioside GM3 is known to participate in the induction of cell differentiation, modulation of cell proliferation, maintenance of fibroblast morphology, signal transduction, and integrin-mediated cell adhesion. The protein encoded by this gene is a type II membrane protein which catalyzes the formation of GM3 using lactosylceramide as the substrate. The encoded protein is a member of glycosyltransferase family 29 and may be localized to the Golgi apparatus.
Uniprot IDQ6NZX4
Protein Accession #NP_003887
Nucleotide Accession #NM_003896
Protein Size (# AA)418
Molecular Weight48kDa
  1. What is the species homology for "ST3GAL5 Antibody - N-terminal region (ARP46385_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit, Sheep".

  2. How long will it take to receive "ST3GAL5 Antibody - N-terminal region (ARP46385_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ST3GAL5 Antibody - N-terminal region (ARP46385_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ST3GAL5 Antibody - N-terminal region (ARP46385_T100)"?

    This target may also be called "SATI, SIAT9, SPDRS, ST3GalV, SIATGM3S, ST3Gal V" in publications.

  5. What is the shipping cost for "ST3GAL5 Antibody - N-terminal region (ARP46385_T100)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "ST3GAL5 Antibody - N-terminal region (ARP46385_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ST3GAL5 Antibody - N-terminal region (ARP46385_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "48kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ST3GAL5 Antibody - N-terminal region (ARP46385_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ST3GAL5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ST3GAL5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ST3GAL5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ST3GAL5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ST3GAL5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ST3GAL5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.