SLC6A16 (NTT5, Orphan Sodium-and Chloride-dependent Neurotransmitter Transporter NTT5, Solute Carrier Family 6 Member 16)
Cat# 133506-100ug
Size : 100ug
Brand : US Biological
133506 Rabbit Anti-SLC6A16 (NTT5, Orphan Sodium-and Chloride-dependent Neurotransmitter Transporter NTT5, Solute Carrier Family 6 Member 16)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgG1,kGrade
Affinity PurifiedApplications
E WBCrossreactivity
HuAccession #
NM_014037Shipping Temp
Blue IceStorage Temp
-20°CSLC6A16 shows structural characteristics of an Na(+)- and Cl(-)-dependent neurotransmitter transporter, including 12 transmembrane (TM) domains, intracellular N and C termini, and large extracellular loops containing multiple N-glycosylation sites.||Applications:|Suitable for use in ELISA and Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|RCCERNAEILLKLINLGKLPPDAKPPVNLLYNPTSIYNAWLSGLPQHIKSMVLREVTECNIETQFLKASEGPKFAFLSFVEAMSFLP*||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.