SLC16A8 (Monocarboxylate Transporter 3, MCT 3, Solute Carrier Family 16 Member 8, MCT3, REMP) (FITC)

Cat# 138347-FITC-100ul

Size : 100ul

Brand : US Biological

Request more information

Contact local distributor :


Phone : +1 850 650 7790


138347-FITC SLC16A8 (Monocarboxylate Transporter 3, MCT 3, Solute Carrier Family 16 Member 8, MCT3, REMP) (FITC)

Clone Type
Polyclonal
Host
rabbit
Source
human
Isotype
IgG
Grade
Affinity Purified
Applications
IHC WB
Crossreactivity
Bo Ca Eq Gp Hu Mo Rb Rt
Shipping Temp
Blue Ice
Storage Temp
-20°C

SLC16A8 is proton-linked monocarboxylate transporter. It catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.||Applications:|Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||Storage and Stability:|Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. |Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.||Note: Applications are based on unconjugated antibody.

Applications
Product Type: Pab|Isotype: IgG|Host: rabbit|Source: human|Concentration: As reported|Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).|Purity: Purified by Protein A affinity chromatography.|Immunogen: Synthetic peptide corresponding to aa RAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTDAAFLLSIVGFVDI from the middle region of human SLC16A8.|Specificity: Recognizes human SLC16A8. Species crossreactivity: mouse, rat canine, zebrafish, bovine, guinea pig, equine, rabbit||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Immunogen
Synthetic peptide corresponding to aa RAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTDAAFLLSIVGFVDI from the middle region of human SLC16A8.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human SLC16A8. Species crossreactivity: mouse, rat canine, zebrafish, bovine, guinea pig, equine, rabbit