Reagents and instruments for immunology, cell biology and molecular biology.
 
> PNOC Antibody - middle region : Biotin

PNOC Antibody - middle region : Biotin

Print Print
Please log in

Cat# ARP56692_P050-Biotin

Size : 100ul

Brand : Aviva Systems Biology

Request more information

Contact local distributor :


Phone : +1 850 650 7790
Datasheets/ManualsPrintable datasheet for anti-PNOC (ARP56692_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PNOC
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: EQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQY
Concentration0.5 mg/ml
Blocking PeptideFor anti-PNOC (ARP56692_P050) antibody is Catalog # AAP56692 (Previous Catalog # AAPP39443)
ReferenceWilliams,J.P., (2008) Anesth. Analg. 106 (3), 865-866
Gene SymbolPNOC
Gene Full NamePrepronociceptin
Alias SymbolsNOP, OFQ, N/OFQ, PPNOC, ppN/OFQ
NCBI Gene Id5368
Protein NamePrepronociceptin
Description of TargetNociceptin is the ligand of the opioid receptor-like receptor (OPRL1). It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. PNOC may be involved in neuronal differentiation and development.
Uniprot IDQ13519
Protein Accession #NP_006219
Nucleotide Accession #NM_006228
Protein Size (# AA)176
Molecular Weight20kDa
Protein InteractionsOPRL1;
Protein interactions
Name# of Products
OPRL110
Biological pathways
Name# of Products
Neuropeptide signaling pathway134
Sensory perception20
Synaptic transmission454
Biological process
Name# of Products
Neuropeptide signaling pathway70
Sensory perception9
Signal transduction1058
Synaptic transmission332
Cellular components
Name# of Products
Extracellular region1573
Protein function
Name# of Products
Neuropeptide hormone activity51
Opioid peptide activity15

  1. What is the species homology for "PNOC Antibody - middle region (ARP56692_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish".

  2. How long will it take to receive "PNOC Antibody - middle region (ARP56692_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PNOC Antibody - middle region (ARP56692_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PNOC Antibody - middle region (ARP56692_P050)"?

    This target may also be called "NOP, OFQ, N/OFQ, PPNOC, ppN/OFQ" in publications.

  5. What is the shipping cost for "PNOC Antibody - middle region (ARP56692_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "PNOC Antibody - middle region (ARP56692_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PNOC Antibody - middle region (ARP56692_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "20kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PNOC Antibody - middle region (ARP56692_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PNOC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PNOC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PNOC"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PNOC"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PNOC"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PNOC"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.