HPV16 E7-E6 Human papillomavirus Recombinant Protein

Cat# TP780004

Size : 50ug

Request more information

Contact local distributor :


Phone :

HPV16 E7-E6 Human papillomavirus Recombinant Protein

SKU
TP780004
Purified recombinant protein of HPV16 E7-E6, with N-terminal 10*His tag, expressed in Pichia Pastoris, 50ug
In Stock*
Specifications
Product Data
Species Human papillomavirus
Expression Host Yeast
Expression cDNA Clone or AA Sequence
Protein Sequence
MHHHHHHHHHHENLYFQGMHGDTPTLHEYMLDLQPETTDLYGYGQLNDSSEEEDEIDGPA GQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVGPICSQKPHQKR TAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGN PYAVGDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINGQKPLCPEEKQRH LDKKQRFHNIRGWTGRCMSCCRSSRTRRETQL
Tag N-10*His
Predicted MW 32.0 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 50 mM Tris-HCl, pH 8.0, 500 mM NaCl, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at +4°C upon receipt.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Write Your Own Review
You're reviewing:HPV16 E7-E6 Human papillomavirus Recombinant Protein
Your Rating
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Products

  • cDNA Clones
  • Antibodies
  • Proteins
  • Vectors
  • RNAi
  • Gene Expression
  • Assay Kits
  • Tissues
  • Others

Product Support

  • Product FAQs
  • Product Manuals
  • SDS
  • Citations

Customer Support

  • Order Support
  • Technical Support
  • International Distributors
  • cDNA Clone Match
  • Product Review

Learning Resources

  • Video and Webinar
  • Brochures & Flyers
  • Protocols
  • Ebooks
  • Scientific Papers
  • Bioinformatics Tools

About Us

  • About Us
  • Press Releases
  • Conferences
  • Customer Testimonials
  • Careers
  • Legal Notices
  • Contact Us