EPM2A (Epilepsy, Progressive Myoclonus Type 2A, Lafora Disease (laforin), EPM2, MELF)
Cat# 245789-100ug
Size : 100ug
Brand : US Biological
245789 EPM2A (Epilepsy, Progressive Myoclonus Type 2A, Lafora Disease (laforin), EPM2, MELF)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgG2a,kGrade
PurifiedApplications
E WBCrossreactivity
HuAccession #
NP_001018051Shipping Temp
Blue IceStorage Temp
-20°CThis gene encodes a dual-specificity phosphatase that associates with polyribosomes. The encoded protein may be involved in the regulation of glycogen metabolism. Mutations in this gene have been associated with myoclonic epilepsy of Lafora. Alternative splicing results in multiple transcript variants. [provided by RefSeq||Applications: |Suitable for use in Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|GNGPHHDRCCTYNENNLVDGVYCLPIGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKLKHELGITAVMNFQTEWDIV||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.