DDP1 Recombinant Protein
Cat# OPCA03304-1MG
Size : 1mg
Brand : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for DDP1 Recombinant Protein (Baker's yeast) (OPCA03304) (OPCA03304) |
---|
Predicted Species Reactivity | Saccharomyces cerevisiae |
---|---|
Product Format | Liquid or Lyophilized powder |
Host | Yeast |
Additional Information | Relevance: May eliminate potentially toxic dinucleoside polyphosphates during sporulation. Most active against diadenosine 5',5'''-P1,P6-hexaphosphate (Ap6A). Can also hydrolyze diadenosine 5',5'''-P1,P5-pentaphosphate (Ap5A), adenosine 5'-pentaphosphate, and adenosine 5'-tetraphosphate are also substrates, but not diadenosine 5',5'''-P1,P4-tetraphosphate (Ap4A) or other dinucleotides, mononucleotides, nucleotide sugars, or nucleotide alcohols. Also cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate) and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate) |
Reconstitution and Storage | -20°C or -80°C |
Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | GKTADNHGPVRSETAREGRENQVYSPVTGARLVAGCICLTPDKKQVLMITSSAHKKRWIVPKGGVEKDEPNYETTAQRETWEEAGCIGKIVANLGTVEDMRPPKDWNKDIKQFENSRKDSEVAKHPPRTEFHFYELEIENLLDKFPECHKRHRKLYSYTEAKQNLIDAKRPELLEALNRSAIIKDDK |
Protein Sequence | GKTADNHGPVRSETAREGRENQVYSPVTGARLVAGCICLTPDKKQVLMITSSAHKKRWIVPKGGVEKDEPNYETTAQRETWEEAGCIGKIVANLGTVEDMRPPKDWNKDIKQFENSRKDSEVAKHPPRTEFHFYELEIENLLDKFPECHKRHRKLYSYTEAKQNLIDAKRPELLEALNRSAIIKDDK |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | E.coli |
Protein Range | 2-188 aa |
Tag | N-terminal 6xHis-SUMO-tagged |
Reference | The diadenosine hexaphosphate hydrolases from Schizosaccharomyces pombe and Saccharomyces cerevisiae are homologues of the human diphosphoinositol polyphosphate phosphohydrolase. Overlapping substrate specificities in a MutT-type protein.Safrany S.T., Ingram S.W., Cartwright J.L., Falck J.R., McLennan A.G., Barnes L.D., Shears S.B.J. Biol. Chem. 274:21735-21740(1999) |
---|---|
Gene Symbol | DDP1 |
Gene Full Name | polyphosphatase DDP1 |
Alias Symbols | Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase;Diadenosine and diphosphoinositol polyphosphate phosphohydrolase 1;Diadenosine hexaphosphate hydrolase (AMP-forming);polyphosphatase DDP1;YOR163W. |
NCBI Gene Id | 854334 |
Protein Name | Diphosphoinositol polyphosphate phosphohydrolase DDP1 |
Description of Target | May eliminate potentially toxic dinucleoside polyphosphates during sporulation. Most active against diadenosine 5',5'''-P1,P6-hexaphosphate (Ap6A). Can also hydrolyze diadenosine 5',5'''-P1,P5-pentaphosphate (Ap5A), adenosine 5'-pentaphosphate, and adenosine 5'-tetraphosphate are also substrates, but not diadenosine 5',5'''-P1,P4-tetraphosphate (Ap4A) or other dinucleotides, mononucleotides, nucleotide sugars, or nucleotide alcohols. Also cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate) and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate). |
Uniprot ID | Q99321 |
Protein Accession # | NP_014806.1 |
Nucleotide Accession # | NM_001183582.1 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 37.4 kDa |