SOX13 (SRY (Sex Determining Region Y)-box 13 Transcription Factor SOX-13, Islet Cell Antigen 12, ICA12, Type 1 Diabetes Autoantigen ICA12) (PE)
Cat# 133716-PE-100ul
Size : 100ul
Brand : US Biological
133716-PE Rabbit Anti-SOX13 (SRY (Sex Determining Region Y)-box 13 Transcription Factor SOX-13, Islet Cell Antigen 12, ICA12, Type 1 Diabetes Autoantigen ICA12) (PE)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgG1,kGrade
Affinity PurifiedApplications
E WBCrossreactivity
HuAccession #
NM_005686Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeApplications:|Suitable for use in ELISA and Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|KSEEKKEPCHEAPQGSATAAEPQPGDPARASQDSADPQAPAQGNFRGSWDCSSPEGNGSPEPKRPGVSEAASGSQEKLDFNRNLKEVVPAIEKLLSSDWKERFLGRNSMEAKDV||Storage and Stability:|Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.||Note: Applications are based on unconjugated antibody.