C10orf10 (Chromosome 10 Open Reading Frame 10, DEPP, FIG)
Cat# 243935-50ug
Size : 50ug
Brand : US Biological
243935 C10orf10 (Chromosome 10 Open Reading Frame 10, DEPP, FIG)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgGGrade
PurifiedApplications
WBCrossreactivity
HuAccession #
NP_008952.1Shipping Temp
Blue IceStorage Temp
-20°CThe expression of this gene is induced by fasting as well as by progesterone. The protein encoded by this gene contains a t-synaptosome-associated protein receptor (SNARE) coiled-coil homology domain and a peroxisomal targeting signal. Production of the encoded protein leads to phosphorylation and activation of the transcription factor ELK1. [provided by RefSeq||Applications: |Suitable for use in Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|MRSRLLLSVAHLPTIRETTEEMLLGGPGQEPPPSPSLDDYVRSISRLAQPTSVLDKATAQGQPRPPHRPAQACRKGRPAVSLRDITARFSGQQPTLPMADTVDPLDWLFGESQEKQPSQRDLPRRTGPSAGLWGPHRQMDSSKPMGAPRGRLCEARMPGHSLARPPQDGQQSSDLRSWTFGQSAQAMASRHRPRPSSVLRTLYSHLPVIHEL||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.