Reagenzien und Instrumente für die Immunologie Zellbiologie und Molekularbiologie
 
> TAF1B Antibody - C-terminal region : Biotin

TAF1B Antibody - C-terminal region : Biotin

Drucken Drucken
Melden Sie sich an

Katalog-Nummer ARP37289_T100-Biotin

Size : 100ul

Marke : Aviva Systems Biology

Weitere Informationen anfordern

Contact local distributor :


Telefonnummer : +1 850 650 7790
Datasheets/ManualsPrintable datasheet for anti-TAF1B (ARP37289_T100) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityMouse, Rat, Guinea Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of mouse TAF1B
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceGuinea Pig: 82%; Mouse: 100%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: YQFILNIFSFLLRIKTSALHEEVSLLEKKLFEKKYNESKKSSGSKKGRRH
Concentration1.0 mg/ml
Blocking PeptideFor anti-TAF1B (ARP37289_T100) antibody is Catalog # AAP37289 (Previous Catalog # AAPP20155)
SubunitB
ReferenceWang,Z., et al., (2004) Gene 325, 25-34
Gene SymbolTAF1B
Gene Full NameTATA box binding protein (Tbp)-associated factor, RNA polymerase I, B
Alias Symbolsp6, p63, mTAFI, TAFI68, Tafi86, 4930408G01Rik, A230108M10Rik
NCBI Gene Id21340
Protein NameTATA box-binding protein-associated factor RNA polymerase I subunit B
Description of TargetTAF1b belongs to the family of TATA box binding protein (Tbp)-associated factors. Promoter selectivity for all three classes of eukaryotic RNA polymerases is brought about by multimeric protein complexes containing TATA box binding protein (TBP) and specific TBP-associated factors (TAFs).
Uniprot IDP97358
Protein Accession #NP_065639
Nucleotide Accession #NM_020614
Protein Size (# AA)586
Molecular Weight64kDa
Protein InteractionsCOPS2; Tbp; Taf1c; Taf1a; Rrn3; Tcf3;
Protein interactions
Name# of Products
Rrn314
Tbp255
Tcf3151
Biological pathways
Name# of Products
Regulation of transcription, DNA-dependent1489
Transcription from RNA polymerase I promoter3
Biological process
Name# of Products
Regulation of transcription, DNA-dependent1734
Transcription from RNA polymerase I promoter24
Transcription, DNA-dependent402
Cellular components
Name# of Products
Nucleus4914
RNA polymerase I transcription factor complex3
Protein function
Name# of Products
DNA binding3958
Protein binding12191

  1. What is the species homology for "TAF1B Antibody - C-terminal region (ARP37289_T100)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Mouse, Rat, Guinea Pig".

  2. How long will it take to receive "TAF1B Antibody - C-terminal region (ARP37289_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TAF1B Antibody - C-terminal region (ARP37289_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TAF1B Antibody - C-terminal region (ARP37289_T100)"?

    This target may also be called "p6, p63, mTAFI, TAFI68, Tafi86, 4930408G01Rik, A230108M10Rik" in publications.

  5. What is the shipping cost for "TAF1B Antibody - C-terminal region (ARP37289_T100)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "TAF1B Antibody - C-terminal region (ARP37289_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TAF1B Antibody - C-terminal region (ARP37289_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "64kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TAF1B Antibody - C-terminal region (ARP37289_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TAF1B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TAF1B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TAF1B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TAF1B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TAF1B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TAF1B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.