SYP (Synaptophysin, Major Synaptic Vesicle Protein p38)
Katalog-Nummer 134147-100ug
Size : 100ug
Marke : US Biological
134147 SYP (Synaptophysin, Major Synaptic Vesicle Protein p38)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgG1,kGrade
Affinity PurifiedApplications
E WBCrossreactivity
HuAccession #
BC064550, AAH64550Shipping Temp
Blue IceStorage Temp
-20°CSynaptophysin (p38) is an abundant integral membrane protein of small synaptic vesicles in the brain. It is also present in endocrine cells, where it is associated with small electron-translucent vesicles. Synaptophysin expression has been widely used as a marker for synaptogenesis in developmental studies in vivo and in vitro and as a marker for neuron-specific cell lineages in tumors of the central nervous system and of peripheral neuroendocrine cell derivation. It has multiple transmembrane regions and a cytoplasmic tail that contains 10 copies of a tyrosine-rich repeat. Biochemical experiments have demonstrated that it transverses the membrane four times and has cytoplasmic carboxyl- and amino-termini. It also contain unstable intramolecular disulfide bonds that spontaneously rearrange, thereby creating higher-order polymers that are larger than the native protein and that have distinctly different biochemical properties. Mutations involving the synaptophysin gene may be responsible for an X-linked disorder. Chromosomal localization of the human gene for synaptophysin established the human SYP locus on the X chromosome in subbands Xpll.22-pll.23. It is involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane.||Applications:|Suitable for use in ELISA and Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLNVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDLVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.