SMT3 Recombinant Protein
Katalog-Nummer OPCA02235-20UG
Size : 20ug
Marke : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for SMT3 Recombinant Protein (Baker's yeast) (OPCA02235) (OPCA02235) |
---|
Predicted Species Reactivity | Saccharomyces cerevisiae |
---|---|
Product Format | Liquid or Lyophilized powder |
Host | Yeast |
Additional Information | Relevance: Not known; suppressor of MIF2 mutations. |
Reconstitution and Storage | -20°C or -80°C |
Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG |
Protein Sequence | SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | E.coli |
Protein Range | 2-98 aa |
Tag | N-terminal 6xHis-SUMO-tagged |
Reference | Ulp1-SUMO crystal structure and genetic analysis reveal conserved interactions and a regulatory element essential for cell growth in yeast.Mossessova E., Lima C.D.Mol. Cell 5:865-876(2000) |
---|---|
Gene Symbol | SMT3 |
Gene Full Name | SUMO family protein SMT3 |
Alias Symbols | SUMO family protein SMT3;YDR510W. |
NCBI Gene Id | 852122 |
Protein Name | Ubiquitin-like protein SMT3 |
Description of Target | Not known; suppressor of MIF2 mutations. |
Uniprot ID | Q12306 |
Protein Accession # | NP_010798.1 |
Nucleotide Accession # | NM_001180818.1 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 27.1 kDa |