SCARA3 (Scavenger Receptor Class A Member 3, Cellular Stress Response Gene Protein , CSR, CSR1, APC7, MSLR1, MSRL1) (MaxLight 490)
Katalog-Nummer 132993-ML490-100ul
Size : 100ul
Marke : US Biological
132993-ML490 SCARA3 (Scavenger Receptor Class A Member 3, Cellular Stress Response Gene Protein , CSR, CSR1, APC7, MSLR1, MSRL1) (MaxLight 490)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgG2a,kGrade
Affinity PurifiedApplications
FLISA WBCrossreactivity
Hu Mo RtAccession #
NM_016240, NP_057324Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeMaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.||Applications:|Suitable for use in FLISA and Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|SFLDDHEENMHDLQYHTHYAQNRTVERFESLEGRMASHEIEIGTIFTNINATDNHVHSMLKYLDDVRLSCTLGFHTHAEELYYLNKSVSIMLGTTDLLRE||Storage and Stability:|Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.||Note: Applications are based on unconjugated antibody.