RORC antibody - N-terminal region
Katalog-Nummer ARP59155_P050
Size : 100ul
Marke : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-RORC (ARP59155_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RORC |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 86%; Dog: 79%; Goat: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 79%; Rat: 86%; Sheep: 79%; Zebrafish: 86% |
Peptide Sequence | Synthetic peptide located within the following region: KICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRN |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-RORC (ARP59155_P050) antibody is Catalog # AAP59155 |
Gene Symbol | RORC |
---|---|
Gene Full Name | RAR-related orphan receptor C |
Alias Symbols | TOR, RORG, RZRG, IMD42, NR1F3, RZR-GAMMA |
NCBI Gene Id | 6097 |
Protein Name | cDNA FLJ40675 fis, clone THYMU2021714, highly similar to NUCLEAR RECEPTOR ROR-GAMMA EMBL BAG53561.1 |
Description of Target | RORC encodes a protein which is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that RORC may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2.The protein encoded by this gene is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that this gene may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2. Two transcript variants encoding different isoforms have been found for this gene. |
Uniprot ID | P51449 |
Protein Accession # | NP_001001523 |
Nucleotide Accession # | NM_001001523 |
Protein Size (# AA) | 497 |
Molecular Weight | 56kDa |
Protein Interactions | EVI2A; NCOA6; EIF3I; CHD4; EIF4EBP1; |