Recombinant Mouse C-X-C motif chemokine 14
Katalog-Nummer OPCA00814-20UG
Size : 20ug
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
| Datasheets/Manuals | Printable datasheet for CXCL14 Recombinant Protein (Mouse) (OPCA00814) (OPCA00814) |
|---|
| Predicted Species Reactivity | Mouse|Mus musculus |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Additional Information | Tag information : His tag |
| Reconstitution and Storage | -20°C or -80°C |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE |
| Protein Sequence | SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 23-99 aa |
| Tag | N-terminal 6xHis-tagged |
| Reference | Cloning of BRAK, a novel divergent CXC chemokine preferentially expressed in normal versus malignant cells.Hromas R., Broxmeyer H.E., Kim C., Nakshatri H., Christopherson K. II, Azam M., Hou Y.-H.Biochem. Biophys. Res. Commun. 255:703-706(1999) |
|---|---|
| Gene Symbol | Cxcl14 |
| Gene Full Name | chemokine (C-X-C motif) ligand 14 |
| Alias Symbols | 1110031L23Rik;1200006I23Rik;AI414372;B-cell and monocyte-activating chemokine;BMAC;bolekine;BR;BRAK;chemokine BRAK;C-X-C motif chemokine 14;Kec;kidney-expressed chemokine CXC;KS1;MIP-;MIP-2g;MIP2gamma;musculus CXC chemokine MIP-2gamma;NJAC;Scyb1;Scyb14;small inducible cytokine subfamily B (Cys-X-Cys), member 14;small-inducible cytokine B14. |
| NCBI Gene Id | 57266 |
| Protein Name | C-X-C motif chemokine 14 |
| Description of Target | Chemotactic for CESS B-cells and THP-1 monocytes, but not T-cells. |
| Uniprot ID | Q9WUQ5 |
| Protein Size (# AA) | Recombinant |
| Molecular Weight | 13.4 kDa |
