Recombinant Mouse C-C motif chemokine 7
Katalog-Nummer OPCA00797-100UG
Size : 100ug
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
| Datasheets/Manuals | Printable datasheet for CCL7 Recombinant Protein (Mouse) (OPCA00797) (OPCA00797) |
|---|
| Predicted Species Reactivity | Mouse|Mus musculus |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Additional Information | Tag information : His tag |
| Reconstitution and Storage | -20°C or -80°C |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | PNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP |
| Protein Sequence | PNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 28-97 aa |
| Tag | N-terminal 6xHis-tagged |
| Reference | Immunoglobulin E plus antigen challenge induces a novel intercrine/chemokine in mouse mast cells.Kulmburg P.A., Huber N.E., Scheer B.J., Wrann M., Baumruker T.J. Exp. Med. 176:1773-1778(1992) |
|---|---|
| Gene Symbol | Ccl7 |
| Gene Full Name | chemokine (C-C motif) ligand 7 |
| Alias Symbols | C-C motif chemokine 7;fi;fic;intercrine/chemokine MARC;ma;marc;mcp;MCP-;mcp3;MCP-3;monocyte chemoattractant protein 3;monocyte chemotactic protein 3;Protein FIC;RANTES/sis homolog;Scy;Scya7;small-inducible cytokine A7. |
| NCBI Gene Id | 20306 |
| Protein Name | C-C motif chemokine 7 |
| Description of Target | Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity (By similarity). |
| Uniprot ID | Q03366 |
| Protein Size (# AA) | Recombinant |
| Molecular Weight | 12.1 kDa |
