Recombinant Mouse C-C motif chemokine 3
Katalog-Nummer OPCA00795-100UG
Size : 100ug
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
| Datasheets/Manuals | Printable datasheet for CCL3 Recombinant Protein (Mouse) (OPCA00795) (OPCA00795) |
|---|
| Predicted Species Reactivity | Mouse|Mus musculus |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Additional Information | Tag information : His tag |
| Reconstitution and Storage | -20°C or -80°C |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA |
| Protein Sequence | APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 24-92 aa |
| Tag | N-terminal 6xHis-tagged |
| Reference | Macrophages secrete a novel heparin-binding protein with inflammatory and neutrophil chemokinetic properties.Wolpe S.D., Davatelis G., Sherry B., Beutler B., Hesse D.G., Nguyen H.T., Moldawer L.L., Nathan C.F., Lowry S.F., Cerami A.J. Exp. Med. 167:570-581(1988) |
|---|---|
| Gene Symbol | Ccl3 |
| Gene Full Name | chemokine (C-C motif) ligand 3 |
| Alias Symbols | AI323804;C-C motif chemokine 3;CCL;G0S19-;G0S19-1;heparin-binding chemotaxis protein;L2G25B;LD78;LD78alpha;macrophage inflammatory protein 1-alpha;macrophage inflammatory protein-1alpha;Mi;MIP-;MIP1;MIP1-;MIP1 (a);MIP1-(a);Mip1a;MIP1-alpha;MIP-1alpha;MIP-1-alpha;Scy;Scya3;SIS-alpha;small-inducible cytokine A3;TY-5. |
| NCBI Gene Id | 20302 |
| Protein Name | C-C motif chemokine 3 |
| Description of Target | Monokine with inflammatory, pyrogenic and chemokinetic properties. Has a potent chemotactic activity for eosinophils. Binding to a high-affinity receptor activates calcium release in neutrophils. |
| Uniprot ID | P10855 |
| Protein Size (# AA) | Recombinant |
| Molecular Weight | 11.9 kDa |
