NODAL (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
- More Files
- Specifications
Product Description
Human NODAL partial ORF ( NP_060525, 275 a.a. - 346 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
RCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGC
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
33.66
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
- Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
- Gene Info — NODAL
Entrez GeneID
4838GeneBank Accession#
NM_018055Protein Accession#
NP_060525Gene Name
NODAL
Gene Alias
MGC138230
Gene Description
nodal homolog (mouse)
Omim ID
601265Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the TGF-beta superfamily. Studies of the mouse counterpart suggested that this gene may be essential for mesoderm formation and subsequent organization of axial structures in early embryonic development. [provided by RefSeq
Other Designations
OTTHUMP00000019754|nodal|nodal, mouse, homolog
- Interactomes
- Pathways
- Diseases