MFN2 Antibody - middle region
Katalog-Nummer ARP89255_P050-25UL
Size : 25ul
Marke : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-YBX3 (ARP89255_P050) antibody |
---|
Tested Species Reactivity | Mouse |
---|---|
Predicted Species Reactivity | Mouse |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse MFN2 |
Purification | Affinity purified |
Peptide Sequence | Synthetic peptide located within the following region: FHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELG |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-MFN2 (ARP89255_P050) antibody is Catalog # AAP89255 |
Publications | Increased ROS-Dependent Fission of Mitochondria Causes Abnormal Morphology of the Cell Powerhouses in a Murine Model of Amyotrophic Lateral Sclerosis. Oxid Med Cell Longev. 2021, 6924251 (2021). 34691359 |
Gene Symbol | MFN2 |
---|---|
Gene Full Name | mitofusin 2 |
Alias Symbols | Fz, Fzo, D630023P19Rik |
NCBI Gene Id | 170731 |
Protein Name | mitofusin-2 |
Description of Target | Mitochondrial outer membrane GTPase that mediates mitochondrial clustering and fusion. Mitochondria are highly dynamic organelles, and their morphology is determined by the equilibrium between mitochondrial fusion and fission events. Overexpression induces the formation of mitochondrial networks. Membrane clustering requires GTPase activity and may involve a major rearrangement of the coiled coil domains (By similarity). Plays a central role in mitochondrial metabolism and may be associated with obesity and/or apoptosis processes. Plays an important role in the regulation of vascular smooth muscle cell proliferation (By similarity). Involved in the clearance of damaged mitochondria via selective autophagy (mitophagy). Is required for PRKN recruitment to dysfunctional mitochondria. Involved in the control of unfolded protein response (UPR) upon ER stress including activation of apoptosis and autophagy during ER stress. Acts as an upstream regulator of EIF2AK3 and suppresses EIF2AK3 activation under basal conditions. |
Uniprot ID | Q80U63-2 |
Protein Accession # | NP_001272849.1 |
Nucleotide Accession # | NM_001285920.1 |
Protein Size (# AA) | 605 |
Molecular Weight | 69 kDa |
-
What is the species homology for "MFN2 Antibody - middle region (ARP89255_P050)"?
The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Mouse".
-
How long will it take to receive "MFN2 Antibody - middle region (ARP89255_P050)"?
This item is available "Domestic: within 24 hours delivery | International: 3-5 days".
-
What buffer format is "MFN2 Antibody - middle region (ARP89255_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "MFN2 Antibody - middle region (ARP89255_P050)"?
This target may also be called "Fz, Fzo, D630023P19Rik" in publications.
-
What is the shipping cost for "MFN2 Antibody - middle region (ARP89255_P050)"?
The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.
-
What is the guarantee for "MFN2 Antibody - middle region (ARP89255_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "MFN2 Antibody - middle region (ARP89255_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "69 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "MFN2 Antibody - middle region (ARP89255_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "MFN2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "MFN2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "MFN2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "MFN2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "MFN2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "MFN2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.