Insr antibody - middle region

Katalog-Nummer ARP41373_P050

Size : 100ul

Marke : Aviva Systems Biology

Weitere Informationen anfordern

Contact local distributor :


Telefonnummer : +1 850 650 7790

Insr Antibody - middle region (ARP41373_P050)

Datasheets/ManualsPrintable datasheet for anti-Insr (ARP41373_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Peptide SequenceSynthetic peptide located within the following region: EEVSGTKGRQERNDIALKTNGDQASCENELLKFSFIRTSFDKILLRWEPY
Concentration0.5 mg/ml
Blocking PeptideFor anti-Insr (ARP41373_P050) antibody is Catalog # AAP41373 (Previous Catalog # AAPP24111)
Gene SymbolInsr
Gene Full NameInsulin receptor
Alias SymbolsI, IR, IR-A, IR-B, CD220, 4932439J01Rik, D630014A15Rik
NCBI Gene Id16337
Protein NameInsulin receptor
Description of TargetThis receptor binds insulin and has a tyrosine-protein kinase activity. When it is present in a hybrid receptor with IGF1R, binds IGF1.
Uniprot IDP15208
Protein Accession #NP_034698
Nucleotide Accession #NM_010568
Protein Size (# AA)1372
Molecular Weight155kDa
Protein InteractionsArrb2; Src; Akt1; Jup; Irs1; Grb10; Snx9; Dok3; Sh2b2; Flot1; Dok1; Cav3; Socs1; Socs3; Sorbs1; Cav1; Pik3r1;

Sie könnten auch an folgenden Produkten interessiert sein:



Katalog-Nummer
Beschreibung
Cond.
Preis zzgl. MwSt.
R111-0100
 100mL