GCM1 (glial Cells missing Homolog 1 (Drosophila), GCMA, hGCMa) (PE)
Katalog-Nummer 246527-PE-100ul
Size : 100ul
Marke : US Biological
246527-PE GCM1 (glial Cells missing Homolog 1 (Drosophila), GCMA, hGCMa) (PE)
Clone Type
PolyclonalHost
mouseIsotype
IgG2b,kGrade
PurifiedApplications
E IF WBAccession #
NP_003634Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeThis gene encodes a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein. [provided by RefSeq||Applications: |Suitable for use in Immunofluorescence, Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|QQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEA*||Storage and Stability:|Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. ||Note: Applications are based on unconjugated antibody.