GCM1 (glial Cells missing Homolog 1 (Drosophila), GCMA, hGCMa)
Katalog-Nummer 246527-100ug
Size : 100ug
Marke : US Biological
246527 GCM1 (glial Cells missing Homolog 1 (Drosophila), GCMA, hGCMa)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgG2b,kGrade
PurifiedApplications
E IF WBCrossreactivity
HuAccession #
NP_003634Shipping Temp
Blue IceStorage Temp
-20°CThis gene encodes a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein. [provided by RefSeq||Applications: |Suitable for use in Immunofluorescence, Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|QQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEA*||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.