GCM1 (Glial Cells Missing Homolog 1 (Drosophila), GCMA, hGCMa) (HRP)
Katalog-Nummer 207658-HRP-100ul
Size : 100ul
Marke : US Biological
207658-HRP Rabbit Anti-GCM1 (Glial Cells Missing Homolog 1 (Drosophila), GCMA, hGCMa) (HRP)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgG2a,kGrade
PurifiedApplications
E WBCrossreactivity
HuAccession #
NP_003634Gene #
GCM1Shipping Temp
Blue IceStorage Temp
-20°CThis gene encodes a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein. ||Applications: |Suitable for use in ELISA and Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|QQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEA*||Storage and Stability:|Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.||Note: Applications are based on unconjugated antibody.