Fusion glycoprotein, partial Recombinant Protein (Human respiratory syncytial virus A )
Katalog-Nummer OPCA05237-20UG
Size : 20ug
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
| Datasheets/Manuals | Printable datasheet for F Recombinant Protein (Human respiratory syncytial virus A) (OPCA05237) (OPCA05237) |
|---|
| Predicted Species Reactivity | Human respiratory syncytial virus A|Human Respiratory Syncytial Virus A |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Additional Information | Species Specificity Detail: Homo sapiens (Human) |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | Tris-base, 50% glycerol |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | NITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITT |
| Protein Sequence | NITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITT |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 27-529 aa |
| Tag | N-terminal 6xHis-B2M-tagged |
| Reference | Nucleotide sequence of the gene encoding the fusion (F) glycoprotein of human respiratory syncytial virus. Collins P.L., Huang Y.T., Wertz G.W. Proc. Natl. Acad. Sci. U.S.A. 81:7683-7687(1984) |
|---|---|
| Gene Symbol | F |
| Alias Symbols | F, Fusion glycoprotein F0, Protein F) [Cleaved into: Fusion glycoprotein F2', Interchain peptide, Fusion glycoprotein F2, Fusion glycoprotein F1] |
| Protein Name | Fusion glycoprotein F0 |
| Description of Target | During virus entry, induces fusion of viral and cellular membranes leading to delivery of the nucleocapsid into the cytoplasm. The fusogenic activity is inactive untill entry into host cell endosome, where a furin-like protease cleaves off a small peptide between F1 and F2 (PubMed:18216092). Interacts directly with heparan sulfate and may participate in virus attachment (PubMed:10864656). Furthermore, the F2 subunit was identifed as the major determinant of RSV host cell specificity (PubMed:11493675). Later in infection, proteins F expressed at the plasma membrane of infected cells can mediate fusion with adjacent cells to form syncytia, a cytopathic effect that could lead to tissue necrosis. The fusion protein is also able to trigger p53-dependent apoptosis (PubMed:12663767). |
| Uniprot ID | P03420 |
| Protein Size (# AA) | Recombinant |
| Molecular Weight | 69.9 kDa |