Western Blot (Cell lysate)
FOXF2 monoclonal antibody (M01), clone 2D7. Western Blot analysis of FOXF2 expression in H9c2(2-1).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FOXF2 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.89 KDa) .
- Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant FOXF2.
Immunogen
FOXF2 (NP_001443, 346 a.a. ~ 443 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SPYLKQPPALTPSSNPAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFHPSASGSYYHHHHQSVCQDIKPCV
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.89 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Cell lysate)
FOXF2 monoclonal antibody (M01), clone 2D7. Western Blot analysis of FOXF2 expression in H9c2(2-1).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FOXF2 is approximately 1ng/ml as a capture antibody.ELISA
- Gene Info — FOXF2
Entrez GeneID
2295GeneBank Accession#
NM_001452Protein Accession#
NP_001443Gene Name
FOXF2
Gene Alias
FKHL6, FREAC2
Gene Description
forkhead box F2
Omim ID
603250Gene Ontology
HyperlinkGene Summary
FOXF2 encodes forkhead box F2, one of many human homologues of the Drosophila melanogaster transcription factor forkhead. FOXF2 is expressed in lung and placenta, and has been shown to transcriptionally activate several lung-specific genes. [provided by RefSeq
Other Designations
OTTHUMP00000017863|forkhead-like 6
- Interactomes
- Diseases